SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000400 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000400
Domain Number 1 Region: 592-863
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-71
Family Protein kinases, catalytic subunit 0.000000000874
Further Details:      
 
Domain Number 2 Region: 28-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-67
Family Ephrin receptor ligand binding domain 0.00000881
Further Details:      
 
Domain Number 3 Region: 328-514
Classification Level Classification E-value
Superfamily Fibronectin type III 1.15e-26
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 4 Region: 851-921
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.17e-19
Family SAM (sterile alpha motif) domain 0.00096
Further Details:      
 
Domain Number 5 Region: 259-330,366-380
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000518
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000400   Gene: ENSPTRG00000000221   Transcript: ENSPTRT00000000459
Sequence length 930
Comment pep:known chromosome:CHIMP2.1.4:1:16248253:16280834:-1 gene:ENSPTRG00000000221 transcript:ENSPTRT00000000459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELQAPRACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQGDSNSYNVRRTEGFSVT
LDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGGVAVGVVLLLVLAG
VGFFIHRRRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCV
TRQKVIGAGEFGEVYKGTLKTSSGKKEVPVAIKTLKAGYKPMMIITEYMENGALDKFLRE
KDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLED
DPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEV
MKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLAD
FDPRVSIRLPSTSGSEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKR
IGVRLPGHQKRIAYSLLGLKDQVNTVGIPI
Download sequence
Identical sequences ENSPTRP00000000400 ENSPTRP00000000400 9598.ENSPTRP00000000400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]