SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000531 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000531
Domain Number 1 Region: 34-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000138
Family Spermadhesin, CUB domain 0.014
Further Details:      
 
Domain Number 2 Region: 173-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000531   Gene: ENSPTRG00000000306   Transcript: ENSPTRT00000000603
Sequence length 272
Comment pep:known chromosome:CHIMP2.1.4:1:21807392:21820688:1 gene:ENSPTRG00000000306 transcript:ENSPTRT00000000603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEACCLLQLPQRLLLLGAAALTATALETADLAELCGQTWQGDALLLRSHAASRRFYFVAP
DTDCGLWVQAADPGDRIRFQFRFFLVYSLTPAPPALNTSSPAPADPCAPGSYLQFYEGPS
GAPRPLGSPLCGLTIPVPVASSGPFLGLRLVTRGRQPRVDFVGEVTSFPLGPCGAYFRCQ
NGRCIPSSLVCDPWGMDNCGDGSDQGSWSPADCRGPSPVPSQTGSTDAHTSRPPTPSPAL
GSAGSLWIAAERSSPAGRDPTRQDAALEGSTE
Download sequence
Identical sequences H2PY95
ENSPTRP00000000531 ENSPTRP00000000531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]