SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000553 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000553
Domain Number 1 Region: 31-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-70
Family Ephrin receptor ligand binding domain 0.00000179
Further Details:      
 
Domain Number 2 Region: 626-795
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-48
Family Protein kinases, catalytic subunit 0.00000054
Further Details:      
 
Domain Number 3 Region: 328-533
Classification Level Classification E-value
Superfamily Fibronectin type III 2.91e-38
Family Fibronectin type III 0.0000043
Further Details:      
 
Domain Number 4 Region: 859-926
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.56e-20
Family SAM (sterile alpha motif) domain 0.000038
Further Details:      
 
Domain Number 5 Region: 259-325,360-386
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000445
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000553   Gene: ENSPTRG00000000316   Transcript: ENSPTRT00000000626
Sequence length 930
Comment pep:novel chromosome:CHIMP2.1.4:1:22561409:22606350:1 gene:ENSPTRG00000000316 transcript:ENSPTRT00000000626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APASQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAAQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDK
EMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDTRT
IVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPG
KLPEPQFYAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQRDV
PVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGHLAMIVTEYMENGSLD
AFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFGLS
RVLEDDPDAAYTTTQLMLDCWKDRAQRPLFSQIVSVLDALIRSPESLRATATVSRCPPPA
FARSCFDLRGGSGGGGGLTVGDWLDSIRMGQYRDHFAAGGYSSLGMVLRMNAQDVRALGI
TLMGHQKKILGSIQTMRAQLTSTQGPRRHL
Download sequence
Identical sequences ENSPTRP00000000553 ENSPTRP00000000553 9598.ENSPTRP00000000553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]