SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000659 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000659
Domain Number 1 Region: 6-80,110-327
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.71e-62
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000659   Gene: ENSPTRG00000000374   Transcript: ENSPTRT00000000745
Sequence length 341
Comment pep:known chromosome:CHIMP2.1.4:1:26114114:26127841:1 gene:ENSPTRG00000000374 transcript:ENSPTRT00000000745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSI
KSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVETSLKGEIAFDPRSAYYLWFVMD
FCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLHKNQIIHRDLKPDNILISQTRLDTS
DLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPEVWEGHYTAKADI
FALGIIIWAMLERITFIDTETKKELLGSYVKQGTEIVPVGEALLENPKMELLIPVKKKSM
NGRMKQLIKEMLAANPQDRPDAFELELRLVQIAFKDSSWET
Download sequence
Identical sequences A0A096MW45 A0A2J8SIK0 A0A2K5D663 A0A2K5K626 A0A2K5L1U6 A0A2K5RQM4 A0A2K5XTC1 A0A2K6B531 A0A2K6MMY3 A0A2K6P0M6 A0A2K6UP04 F7I2V6 G1RD92 G3RVD5 G7MHQ8 G8F381 H2PYD4 Q8N165
9598.ENSPTRP00000000659 9606.ENSP00000363387 ENSNLEP00000011191 ENSNLEP00000023639 ENSCJAP00000017593 ENSCJAP00000017607 ENSPTRP00000000659 gi|22779870|ref|NP_690048.1| NP_001230461.1.87134 NP_001230461.1.92137 NP_001230462.1.87134 NP_001230462.1.92137 NP_690048.1.87134 NP_690048.1.92137 XP_001137143.2.37143 XP_002750505.1.60252 XP_002750506.1.60252 XP_003271689.1.23891 XP_003271690.1.23891 XP_003307946.1.37143 XP_003809502.1.60992 XP_003809503.1.60992 XP_003934872.1.74449 XP_003934873.1.74449 XP_004025269.1.27298 XP_004025271.1.27298 XP_005245800.1.92137 XP_005544424.1.63531 XP_005544425.1.63531 XP_010353985.1.97406 XP_011761249.1.29376 XP_011761250.1.29376 XP_011810996.1.43180 XP_011837016.1.47321 XP_011935449.1.92194 XP_011935450.1.92194 XP_012295638.1.9421 XP_012295639.1.9421 XP_014199490.1.60992 XP_014987260.1.72884 XP_014987269.1.72884 XP_017390130.1.71028 XP_017390131.1.71028 XP_017711686.1.44346 XP_017711687.1.44346 ENSP00000363387 ENSP00000363389 ENSP00000480635 ENSPTRP00000000659 ENSCJAP00000017593 ENSP00000363387 ENSP00000363389 ENSGGOP00000019765 ENSNLEP00000011191 ENSP00000363389 ENSPANP00000004086 ENSGGOP00000019765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]