SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000693 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000693
Domain Number 1 Region: 26-254
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-48
Family Nuclear receptor ligand-binding domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000693   Gene: ENSPTRG00000000394   Transcript: ENSPTRT00000000781
Sequence length 257
Comment pep:known chromosome:CHIMP2.1.4:1:26913634:26916224:-1 gene:ENSPTRG00000000394 transcript:ENSPTRT00000000781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSQPGACPCQGAASRPAILYALLSSSLRAVPRPRSRCLCRQHRPVQLCAPHRTCREAL
DVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKK
ILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVP
GLQAASHIGHLQQEAHWALCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPI
IGDVDIAGLLGDMLLLR
Download sequence
Identical sequences H2PYE6
ENSPTRP00000000693 XP_001146990.1.37143 XP_003809477.1.60992 ENSPTRP00000000693 9598.ENSPTRP00000000693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]