SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000811 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000811
Domain Number 1 Region: 361-416
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000693
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 2 Region: 310-356
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 416-471
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000034
Family TSP-1 type 1 repeat 0.00066
Further Details:      
 
Domain Number 4 Region: 475-522
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000706
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 922-1113,1150-1219
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000165
Family Rhodopsin-like 0.041
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000000811
Domain Number - Region: 533-576
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00392
Family Hormone receptor domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000811   Gene: ENSPTRG00000000465   Transcript: ENSPTRT00000000907
Sequence length 1584
Comment pep:known chromosome:CHIMP2.1.4:1:31849479:31888393:-1 gene:ENSPTRG00000000465 transcript:ENSPTRT00000000907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENTGWMGKGHRMTPACPLLLSVILSLRLAAAFDPAPSACSALASGVLYGAFSLQDLFPT
IASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ
AESEVGRPEEEEAEAAAGLELCSGSGPFTFLHFDKNFVQLCLSAEPSEAPRLLAPAALAF
RFVEVLLINNNNSSQFTCGVLCRWSEECGRAAGRACGFAQPGCSCPGEAGAGSATTTSPG
PPAAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRYGEEPEEEPKVKTQWPRSADEP
GLYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPLRETRPCNNSAT
CPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAACPVEG
QWLEWGPWGPCSTSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGP
WNAWSLCSKTCDTGWQRRFRMCQATGTQGYPCEGTGEEVKPCSEKRCPAFHEMCRDEYVM
LMTWKKAAAGEIIYNKCPPNASGSASRRCLLSAQGVAYWGLPSFARCISHEYRYLYLSLR
EHLAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLLFSVDILRNVTDTFKRATYVPSAD
DVQRFFQVVSFMVDAENKEKWDDAQQVSPGSVHLLRVVEDFIHLVGDALKAFQSSLIVTD
NLVISIQREPVSAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSSPGKPATSGAA
GSPGRGRGPGTVPPGPGHSHQRLLPADPDESSYFVIGAVLYRTLGLILPPPRPPLAVTSR
VMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASWDYSRADASSGDWDTENCQTLETQ
AAHTRCQCQHLSTFAVLAQPPKDLTLELAGSPSVPLVIGCAVSCMALLTLLAIYAAFWRF
IKSERSIILLNFCLSILASNILILVGQSRVLSKGVCTMTAAFLHFFFLSSFCWVLTEAWQ
SYLAVIGRMRTRLVRKRFLCLGWGLPALVVAVSVGFTRTKGYGTSSYCWLSLEGGLLYAF
VGPAAVIVLVNMLIGIIVFNKLMARDGISDKSKKQRAGSERCPWASLLLPCSACGAVPSP
LLSSASARNAMASLWSSCVVLPLLALTWMSAVLAMTDRRSVLFQALFAVFNSAQGFVITA
VHCFLRREVQDVVKCQMGVCRADESEDSPDSCKNGQLQILSDFEKDVDLACQTVLSRVNT
CNPSTITGTLSRLSLDEDEEPKSCLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEA
NPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSLQPGSGGGGGEDAPRARPEGT
PRRAAKTVAHTEGYPSFLSVDHSGLGLGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGER
SRTMPRTVPGSTMKMGSLERKKLRYSDLDFEKVMHTRKRHSELYHELNQKFHTFDRYRSQ
STAKREKRWSVSSGGAAERSVCTDKPSPGERPSLSQHRRHQSWSTFKSMTLGSLPPKPRE
RLTLHRAAAWEPTEPPDGDFQTEV
Download sequence
Identical sequences ENSPTRP00000000811 ENSPTRP00000000811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]