SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000847 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000847
Domain Number 1 Region: 7-266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-78
Family Protein kinases, catalytic subunit 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000847   Gene: ENSPTRG00000000483   Transcript: ENSPTRT00000000945
Sequence length 268
Comment pep:known chromosome:CHIMP2.1.4:1:32501553:32503724:1 gene:ENSPTRG00000000483 transcript:ENSPTRT00000000945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQ
IVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVE
AIRYCHGFGVAHRDLKCENALLQGFNLKLTDFGFAKVLPKSHRELSQTFCGSTAYAAPEV
LQGIPHDSKKGDVWSMGVVLYVMLCASLPFDDTDIPKMLWQQQKGVSFPTHLSISADCQD
LLKRLLEPDMILRPSIEEVSWHPWLAST
Download sequence
Identical sequences H2PYK5
XP_001162347.1.37143 ENSPTRP00000000847 9598.ENSPTRP00000000847 ENSPTRP00000000847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]