SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000970 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000970
Domain Number 1 Region: 38-143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-16
Family Growth factor receptor domain 0.0019
Further Details:      
 
Domain Number 2 Region: 147-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000589
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000970   Gene: ENSPTRG00000000550   Transcript: ENSPTRT00000001077
Sequence length 263
Comment pep:known chromosome:CHIMP2.1.4:1:37842264:37864318:-1 gene:ENSPTRG00000000550 transcript:ENSPTRT00000001077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGLCVVALVLSWTHLTISSWGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKL
FILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYL
HKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKKKLCGFRRGSEERTRRVL
HAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSR
RRKGQQQQQQQGTVGPLTSAGPA
Download sequence
Identical sequences H2PYP4
9598.ENSPTRP00000000970 XP_001169700.1.37143 XP_009452275.1.37143 ENSPTRP00000000970 ENSPTRP00000000970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]