SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000976 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000976
Domain Number 1 Region: 309-602
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.51e-66
Family Protein kinases, catalytic subunit 0.00000006
Further Details:      
 
Domain Number 2 Region: 10-208
Classification Level Classification E-value
Superfamily Fibronectin type III 1.29e-26
Family Fibronectin type III 0.00045
Further Details:      
 
Domain Number 3 Region: 606-677
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.51e-16
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000976   Gene: ENSPTRG00000000553   Transcript: ENSPTRT00000001083
Sequence length 682
Comment pep:novel chromosome:CHIMP2.1.4:1:37951468:37987138:-1 gene:ENSPTRG00000000553 transcript:ENSPTRT00000001083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPRPCAASGPPSAPRDLQYSLSRSPLALRLRWLPPADSGGRSDVTYSLLCLRCGREGPA
GACEPCGPRVAFVPRQAGLRERAATLLHLRPGARYTVRVAALNGVSGPAAAAGTTYAQVT
VSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEYEIRYYEKGQSEQTYSM
VKTGAPTVTVTNLKPATRYVFQIRAASPGPSWEAQSFNPSIEVQTLGEAASGSRDQSPAI
VVTVVTISALLVLGSVMSVLAIWRRPCSYGKGGGDAHDEEELYFHFKVPTRRTFLDPQSC
GDPLQAVHLFAKELDAKSVTLERSLGGGRFGELCCGCLQLPGRQELPVAVHTLRNSASDS
QRLGFLAEALTLGQFDHSHIVRLEGVVTRGSTLMIVTEYMSHGALDGFLRRHEGQLVAGQ
LMGLLPGLASAMKYLSEMGYVHRGLAARHVLVSSDLVCKISGFGRGPRDRSEAVYTTMSG
RSPALWAAPETLQFGHFSSASDVWSFGIIMWEVMAFGERPYWDMSGQDVIKAVEDGFRLP
PPRNCPNPLHRLMLDCWQKDPGERPRFSQIHSXXXXXXXXXXCRLSTAPLTRRPPTPLAD
RAFSTFPSFGSVGAWLEALDLCRYKDSFAAAGYGSLEAVAEMTAQDLVSLGISSAEHREA
LLSGISALQARVLQLQGQGVQV
Download sequence
Identical sequences ENSPTRP00000000976 ENSPTRP00000000976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]