SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001150 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001150
Domain Number 1 Region: 1-224
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-60
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 342-423
Classification Level Classification E-value
Superfamily Polo-box domain 5.89e-24
Family Polo-box duplicated region 0.0011
Further Details:      
 
Domain Number 3 Region: 287-327
Classification Level Classification E-value
Superfamily Polo-box domain 0.00000161
Family Polo-box duplicated region 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001150   Gene: ENSPTRG00000000662   Transcript: ENSPTRT00000001263
Sequence length 427
Comment pep:known chromosome:CHIMP2.1.4:1:45144223:45148477:1 gene:ENSPTRG00000000662 transcript:ENSPTRT00000001263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFG
LAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADL
KETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSIDQILRHDFFTKGYTPDRLPI
SSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKKSKNHAQESDEVSGLVSGLMRTSVGHQD
ARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDGFEEGLTVATVVESALCALRNCVAF
MPPAEQNPAPLAQPEPLVWVSKWVDYGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSD
GTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRL
LRDRSPA
Download sequence
Identical sequences 9598.ENSPTRP00000001150 ENSPTRP00000001150 ENSPTRP00000001150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]