SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001162 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001162
Domain Number 1 Region: 57-318
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.99e-66
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001162   Gene: ENSPTRG00000000673   Transcript: ENSPTRT00000001280
Sequence length 571
Comment pep:known chromosome:CHIMP2.1.4:1:45692655:45846010:-1 gene:ENSPTRG00000000673 transcript:ENSPTRT00000001280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRASGQVMALKMNTLNSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDVSMGSEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP
SFVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDKIPHKSPCPRR
TIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVNPFSARQDLMGGKIKFFDLPS
KSVISLVFDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSD
GPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASE
EMEVEERPAGSTPATFSTSGIGLQTQGKQDG
Download sequence
Identical sequences A0A2J8M046
ENSPTRP00000001162 9598.ENSPTRP00000001162 ENSPTRP00000001162 XP_003812826.1.60992 XP_014200296.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]