SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001363 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001363
Domain Number 1 Region: 544-590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 2 Region: 123-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000119
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 63-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000001363
Domain Number - Region: 499-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001363   Gene: ENSPTRG00000000792   Transcript: ENSPTRT00000001500
Sequence length 591
Comment pep:known chromosome:CHIMP2.1.4:1:57459417:57498056:-1 gene:ENSPTRG00000000792 transcript:ENSPTRT00000001500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPYSFESNAVNKSFAKSRQMRSVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDF
ERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVKQNMKQALEEFQREVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NIPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Download sequence
Identical sequences 9598.ENSPTRP00000001363 ENSPTRP00000001363 ENSPTRP00000001363 XP_009457007.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]