SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001672 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001672
Domain Number 1 Region: 1-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-79
Family FCH domain 0.00000000861
Further Details:      
 
Domain Number 2 Region: 522-595
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-17
Family SH3-domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000001672
Domain Number - Region: 400-467
Classification Level Classification E-value
Superfamily HR1 repeat 0.0115
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001672   Gene: ENSPTRG00000000970   Transcript: ENSPTRT00000001828
Sequence length 605
Comment pep:known chromosome:CHIMP2.1.4:1:94221485:94329479:1 gene:ENSPTRG00000000970 transcript:ENSPTRT00000001828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSK
DEEPRFTSCVAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHDLKTERKMHLQEGR
KAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTH
MADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKV
IPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTIS
ASKQESGKMDAKTTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGSQFLTFSIEPV
HYCMNEIKTGKPRIPSFRSLKRGWSVKMGPALEDFSHLPPEQRRKKLQQRIDELNRELQK
ESDQKDALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTG
GRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHNEFDDEFEDDDPLPAI
GHCKAIYPFDGHNEGTLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTLEK
NSKGS
Download sequence
Identical sequences H2PZF1 Q5T0N5
ENSP00000271234 ENSPTRP00000001672 ENSPTRP00000001672 ENSP00000397451 NP_001157945.1.87134 NP_001157945.1.92137 XP_524770.3.37143 ENSP00000271234 gi|256600192|ref|NP_001157945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]