SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000001800 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000001800
Domain Number 1 Region: 338-540
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000000164
Family Mannose 6-phosphate receptor domain 0.0065
Further Details:      
 
Domain Number 2 Region: 262-343
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000224
Family Growth factor receptor domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000001800
Domain Number - Region: 59-98
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000698
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000001800   Gene: ENSPTRG00000001042   Transcript: ENSPTRT00000001960
Sequence length 696
Comment pep:known chromosome:CHIMP2.1.4:1:109914211:109932402:1 gene:ENSPTRG00000001042 transcript:ENSPTRT00000001960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKGSSSCNVRPACTDKDYFYTHTACDANGETQLMYKWAKPKICSEDLEGAVKLPASGVKT
HCPPCNPGFFKTNNSTCQPCPYGSYSNGSDCTRCPAGTEPAVGFEYKWWNTLPTNMETTV
LSGINFEYKGMTGWEVAGDHIYTAAGASDNDFMILTLVVPGFRPPQSVMADTENKEVARI
TFVFETLCTVNCELYFMVGVNSRTNTPVETWKGSKGKQSYTYIIEENTTTSFTWAFQRTT
FHEASRKYTNDVAKIYSINVTNVMNGVASYCRPCALEASDVGSSCTSCPAGYYIDRDSGT
CHSCPSNTILKAHQPYGVQACVPCGPGTKNNKIHSLCYNDCTFSRNTPTRTFNYNFSALA
NTVTLAGGPSFTSKGLKYFHHFTLSLCGNQGRKMSVCTDNVTDLRIPEGESGFSKSITAY
VCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVTTDMTLDGITSPAELFHPESLGIPDVIF
FYRSNDVTQSCSSGRSTTIRVRCNPQKTVPGSLLLPGTCSDGTCDGCNFHFLWESAAACP
LCSVADYHAIVSSCVAGIQKTTYVWREPKLCSGGISLPEQRVTICKTIDFWLKVGISAGT
CTAILLTVLTCYFWKKNQKLEYKYSKLVMNATLKDCDLPAADSCAIMEGEDVEDDLIFTS
KKSLFGKIKSFTSKRTPDGFDSVPLKTSSGGPDMDL
Download sequence
Identical sequences ENSPTRP00000001800 ENSPTRP00000001800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]