SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002134 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002134
Domain Number 1 Region: 997-1048
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 935-993
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 44-77
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000876
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 806-864
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000126
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 748-806
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 6 Region: 868-931
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000824
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000002134
Domain Number - Region: 691-746
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000458
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002134   Gene: ENSPTRG00000001258   Transcript: ENSPTRT00000002331
Sequence length 1097
Comment pep:known chromosome:CHIMP2.1.4:1:128717079:128728918:1 gene:ENSPTRG00000001258 transcript:ENSPTRT00000002331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESWTGRPWLYLLLLLSLPQLCLDQEVLSGHSLQTPTEEGQGPEGVWGPWVQWASCSQPC
GVGVQRRSRTCQLPTVQLRPSLLLPPRPPRHPEALLPRGQGPRPQTSPETLPLYRTQSRG
RGGPLRGPASHLGREETQEIRAARRSRLRDPIKPGMFGYGRVPFALPLHRNRRHPRRPPR
SELSLISSRGEEPIPSPTPRAEPFSANGSPQTELPPTELSVHTPSPPAEPLSPETAQTEV
APRTRPAPLRHHPRAQASGTEPPSPTHSLGEGGFFRASPQPRRPSSQGWASPQVAGRRPD
PFPSVPRGRGQQGQGPWGTGGTPHWPRLEPDPQHPGAWLPLLSNGPHASSLWSLFAPSSP
IPRCSGESEQLRACSQAPCPPEQPDPRALQCAAFNSQEFMGQLYQWEPFTEAPLLPLRHA
FFLLPGAGSGDSTGVQGSQRCELNCRPRGFRFYVRHTEKVQDGTLCQPGAPDICVAGRCL
SPGCDGILGSGRRPDGCGVCGGDDSTCRLVSGNLTDRGGPLGYQKILWIPAGASRLQIAQ
LRPSSNYLALRGPGGRSIINGNWAVDPPGSYRAGGTVFRYNRPPREEGKGESLSAEGPTT
QPVDVYMIFQEENPGVFYQYVISSPPPILENPTPEPPVPQLQPEILRVEPPLAPAPRPAR
TPGTLQRQVRIPQMPAPPHPRTPLGSPAAYWKRVGHSACSASCGKGVWRPIFLCISRESG
EELDERSCAAGARPPASPEPCHGTPCPPYWEAGEWTSCSRSCGPGTQHRQLQCRQEFGGG
GSSVPPERCGHLPRPNITQSCQLRLCGHWEVGSPWSQCSVRCGRGQRSRQVRCVGNNGDE
VSEQECASGPPQPPSREACDMGPCTTAWFHSDWSSKCSAECGTGIQRRSVVCLGSGAALG
PGQGEAGAGTGQSCPTGSRPPDMRACSLGPCERTWRWYTGPWGECSSECGSGTQRRDIIC
VSKLGTEFNVTSPSNCSHLPRPPALQPCQGQACQDRWFSTPWSPCSRSCQGGTQTREVQC
LSTNQTLSTRCPPQLRPSRKRPCNSQPCSQRPDDQCKDSSPHCPLVVQARLCVYPYYTAT
CCRSCAHVLERSPQDPS
Download sequence
Identical sequences A0A2I3RLR4
ENSPTRP00000002134 ENSPTRP00000002134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]