SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002288 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002288
Domain Number 1 Region: 33-456
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.78e-116
Family L-arabinose binding protein-like 0.000000000000994
Further Details:      
 
Domain Number 2 Region: 859-1050
Classification Level Classification E-value
Superfamily Nucleotide cyclase 6.12e-67
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000433
Further Details:      
 
Domain Number 3 Region: 554-812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.04e-47
Family Protein kinases, catalytic subunit 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002288   Gene: ENSPTRG00000001359   Transcript: ENSPTRT00000002490
Sequence length 1059
Comment pep:known chromosome:CHIMP2.1.4:1:131925349:131939628:1 gene:ENSPTRG00000001359 transcript:ENSPTRT00000002490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHADNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDVS
ARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYI
QAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFR
VVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGSL
SLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNYG
SLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGA
CTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNL
KSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAGD
VYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFLPSLALQSHLEELGLLMQ
LSWAEDPRECPPFQHILLTHKYNWENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEK
RKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLN
DLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIR
HRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKA
VLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
Download sequence
Identical sequences ENSPTRP00000002288 ENSPTRP00000002288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]