SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002772 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002772
Domain Number 1 Region: 34-249
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.95e-19
Family Protein kinases, catalytic subunit 0.0076
Further Details:      
 
Domain Number 2 Region: 253-412
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000128
Family HEAT repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002772   Gene: ENSPTRG00000001665   Transcript: ENSPTRT00000003020
Sequence length 742
Comment pep:known chromosome:CHIMP2.1.4:1:148250341:148294675:-1 gene:ENSPTRG00000001665 transcript:ENSPTRT00000003020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSENSALKSYTLKEPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKVNKAAKHLKTL
RHPCLLRFLSCTVEVDGIHLVTERVQPLEVALETLSSAEVCAGIYDILLALIFLHDRGHL
THNNVCLSSVFVSEDGHWKLGGMETVCKVSQATPEFLRSIQSIRDPASIPPEEMSPEFTT
LPECHGHARDAFSFGTLVESLLTILNEQVSADVLSSFQQTLHSTLLNPIPKCRPALCTLL
SHDFFRNDFLEVVNFLKSLTLKSEEEKTEFFKFLLDRVSCLSEELIASRLVPLLLNQLVF
AEPVAVKSFLPYLLGPKKDHAQGETPCLLSPALFQSRVIPVLLQLFEVHEEHVRMVLLSH
IEAYVEHFTQEQLKKVILPQVLLGLRDTSDSIVAITLHSLAVLVSLLGPEVVVGGERTKI
FKRTAPSFTKNIDLSLEDSPMRVVCSHHSQISPILENPFSSIFPKCFFSGSMPINSKKHI
QRDYYNTLLQTGDPFSQPIKFPINGLSDVKNTSEDSENFPSSSKKSEEWPDWSEPEEPEN
QTVNIQIWPRETCDDVKSQCTTLDVEESSWDDCEPSSLDTKVNPGGGITATKPVTSGEQK
PIPALLSLTEESMPWKSSLPQKTSLVQRGDDADQIKPPKVSSQERPLKVPSELGLGEEFT
IQVKKKPVKDPEMDWFADMIPEIKPSAAFLILPELRTEMVPKKDDVSPVMQFSSKFAAAE
ITEGEAEGWEEEGELNWEDNNW
Download sequence
Identical sequences A0A2I3TFN7
ENSPTRP00000002772 XP_009436225.1.37143 XP_009436230.1.37143 XP_016787676.1.37143 XP_016787679.1.37143 XP_016787686.1.37143 XP_513987.1.37143 9598.ENSPTRP00000002772 ENSPTRP00000002772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]