SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002974 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002974
Domain Number 1 Region: 4870-5085
Classification Level Classification E-value
Superfamily GFP-like 9e-62
Family Domain G2 of nidogen-1 0.0008
Further Details:      
 
Domain Number 2 Region: 2474-2573
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-25
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 1164-1261
Classification Level Classification E-value
Superfamily Immunoglobulin 9.11e-25
Family I set domains 0.0084
Further Details:      
 
Domain Number 4 Region: 3241-3342
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-24
Family I set domains 0.005
Further Details:      
 
Domain Number 5 Region: 2393-2481
Classification Level Classification E-value
Superfamily Immunoglobulin 2.62e-24
Family I set domains 0.023
Further Details:      
 
Domain Number 6 Region: 3627-3719
Classification Level Classification E-value
Superfamily Immunoglobulin 3.74e-24
Family I set domains 0.0067
Further Details:      
 
Domain Number 7 Region: 4074-4171
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-24
Family I set domains 0.015
Further Details:      
 
Domain Number 8 Region: 3051-3153
Classification Level Classification E-value
Superfamily Immunoglobulin 4.18e-24
Family I set domains 0.0085
Further Details:      
 
Domain Number 9 Region: 2582-2669
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-23
Family I set domains 0.0098
Further Details:      
 
Domain Number 10 Region: 2879-2967
Classification Level Classification E-value
Superfamily Immunoglobulin 4.14e-23
Family I set domains 0.0063
Further Details:      
 
Domain Number 11 Region: 3979-4078
Classification Level Classification E-value
Superfamily Immunoglobulin 5.19e-23
Family I set domains 0.033
Further Details:      
 
Domain Number 12 Region: 2962-3058
Classification Level Classification E-value
Superfamily Immunoglobulin 5.99e-23
Family I set domains 0.0061
Further Details:      
 
Domain Number 13 Region: 2680-2768
Classification Level Classification E-value
Superfamily Immunoglobulin 8.64e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 14 Region: 2286-2387
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 15 Region: 4345-4442
Classification Level Classification E-value
Superfamily Immunoglobulin 2.16e-22
Family I set domains 0.0079
Further Details:      
 
Domain Number 16 Region: 603-700
Classification Level Classification E-value
Superfamily Immunoglobulin 2.81e-22
Family I set domains 0.02
Further Details:      
 
Domain Number 17 Region: 3708-3806
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 18 Region: 3902-3994
Classification Level Classification E-value
Superfamily Immunoglobulin 3.66e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 19 Region: 2789-2871
Classification Level Classification E-value
Superfamily Immunoglobulin 7.36e-22
Family I set domains 0.022
Further Details:      
 
Domain Number 20 Region: 1086-1177
Classification Level Classification E-value
Superfamily Immunoglobulin 7.78e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 21 Region: 1821-1920
Classification Level Classification E-value
Superfamily Immunoglobulin 7.86e-22
Family I set domains 0.0094
Further Details:      
 
Domain Number 22 Region: 786-885
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 23 Region: 3146-3246
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-21
Family I set domains 0.0086
Further Details:      
 
Domain Number 24 Region: 1366-1455
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 25 Region: 1447-1548
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-21
Family I set domains 0.025
Further Details:      
 
Domain Number 26 Region: 4164-4262
Classification Level Classification E-value
Superfamily Immunoglobulin 2.43e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 27 Region: 2102-2197
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-21
Family I set domains 0.007
Further Details:      
 
Domain Number 28 Region: 3800-3899
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-21
Family I set domains 0.0058
Further Details:      
 
Domain Number 29 Region: 42-217
Classification Level Classification E-value
Superfamily vWA-like 2.97e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 30 Region: 1542-1641
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-21
Family I set domains 0.0048
Further Details:      
 
Domain Number 31 Region: 1745-1828
Classification Level Classification E-value
Superfamily Immunoglobulin 3.73e-21
Family I set domains 0.036
Further Details:      
 
Domain Number 32 Region: 889-983
Classification Level Classification E-value
Superfamily Immunoglobulin 3.94e-21
Family I set domains 0.0086
Further Details:      
 
Domain Number 33 Region: 4250-4348
Classification Level Classification E-value
Superfamily Immunoglobulin 8.5e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 34 Region: 3442-3529
Classification Level Classification E-value
Superfamily Immunoglobulin 8.75e-21
Family I set domains 0.0089
Further Details:      
 
Domain Number 35 Region: 2008-2107
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 36 Region: 3535-3622
Classification Level Classification E-value
Superfamily Immunoglobulin 2.09e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 37 Region: 1918-2014
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 38 Region: 1634-1735
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-19
Family I set domains 0.0041
Further Details:      
 
Domain Number 39 Region: 4433-4527
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 40 Region: 518-617
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-19
Family I set domains 0.063
Further Details:      
 
Domain Number 41 Region: 3352-3435
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 42 Region: 1268-1361
Classification Level Classification E-value
Superfamily Immunoglobulin 2.9e-19
Family I set domains 0.0051
Further Details:      
 
Domain Number 43 Region: 2191-2292
Classification Level Classification E-value
Superfamily Immunoglobulin 6.55e-19
Family I set domains 0.0079
Further Details:      
 
Domain Number 44 Region: 701-799
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 45 Region: 981-1074
Classification Level Classification E-value
Superfamily Immunoglobulin 3.39e-17
Family I set domains 0.0088
Further Details:      
 
Domain Number 46 Region: 5091-5236
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.26e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 47 Region: 4639-4697
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000144
Family TSP-1 type 1 repeat 0.00017
Further Details:      
 
Domain Number 48 Region: 4527-4583
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000109
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 49 Region: 4582-4640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000124
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 50 Region: 4811-4868
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 51 Region: 4697-4754
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000628
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 52 Region: 4753-4811
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000131
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 53 Region: 5236-5354
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000133
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 54 Region: 5411-5527
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000471
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 55 Region: 445-524
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000104
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002974   Gene: ENSPTRG00000001780   Transcript: ENSPTRT00000003230
Sequence length 5635
Comment pep:known chromosome:CHIMP2.1.4:1:164359806:164816245:1 gene:ENSPTRG00000001780 transcript:ENSPTRT00000003230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWEVVHTVFLFALLYSSLAQDASPQSEIRAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLTGDCDDRTH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQAVNTWRIPF
DPSLKEVTVSLSGPSPMIEIRSPLGKLIKKGFGLHELLNIHNSAKVVNVKEPEAGMWTVK
TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSGISTPARID
LLELLSISGSSLKTIPVKYYPDRKPYGIWNISDFVPPNEAFFLKVTGYDKDDYLFQRVSS
VSFSNIVPDAPKVTMPEKTPGYYLQPGQIPCSVDSLLPFTLSFVRNGVTLGVDQYLKESA
SVNLDIEKVILSDEGFYECIAVSSAGTGRAQTFFDVSEPPPVIQVPNNVTVTPGERAVLT
CLIISAVDYNLTWQRNDRDVRLAEPARIRTLANLSLELTSVKFNDAGEYHCMVSSEGGSS
AASVFLTVQEPPKVTVMPKNQSFTGGSEVSVMCSATGYPKPKIAWTVNDMFIVGSHRYRM
TSDGTLFIKNAAPKDAGIYGCLASNSAGTDKQNSTLRYIEAPKLMVVQSELLVALGDITV
MECKTSGIPPPQVKWFKGDLELRPSTFLIIDPLLGLLKIQETQDLDAGDYTCVAINEAGR
ATGKITLDVGSPPVFIQEPADVSMEIGSNVTLPCYVQGYPEPTVKWRRLDNMPIFSRPFS
VSSISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTVTGLVAPLIGISPSVAN
VIEGQQLTLPCTLLAGNPIPERRWIKNSAMLLQNPYITVRSDGSLHIERVQLQDGGEYTC
VASNVAGTNNKTTSVVVHVLPTIQHGQQILSTIEGIPVTLPCKASGIPKPSVIWSKKGEL
ISTSGAKFSAGADGSLYVVSPGGEESGEYVCTATNAAGYAKRKVQLTVYVRPRVFGDQRG
LSQDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITET
RTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLP
VITWSKGGSTMLVDGEHHVSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQE
PPTVEDLEPPYNTPFQERVANQRIAFPCPAKGTPKPTIKWLHNGRELTGREPGISILEDD
TLLVIASVTPYDNGEYICVAVNEAGTTERKYNLKVHVPPVIKDKEQVTNVSVLLNQLTNL
FCEVEGTPSPIIMWYKDNVQVTESSTIQIVNNGKILKLFKATPEDAGRYSCKAINIAGTS
QKYFNIDVLVPPTIIGTNFPNEVSVVLNRDVALECQVKGTPFPDIHWFKDGKPLFLGDPN
VELLDRGQVLHLKNARRNDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTTDISVL
INSLIKLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYLHIPRAQVSDSATYTCHV
ANVVGTAEKSFHVDVYVPPMIEGNLAMPLNKQVVIAHSLTLECKAAGNPSPILTWLKDGV
PVKANDNIRIEAGGKKLEILNAQEIDRGQYICVATSVAGEKEIKYEVDVLVPPAIEGGDE
TSYFIVMVNNLLELDCHVTGSPPPTIMWLKDGQLIDERDGFKILLNGRKLVIAQAQVSDT
GLYWCMAANTAGDHKKEFEVTVHVPPTIKSSGLSERVVVKYKPVALQCIANGIPNPSITW
LKDDQPVNTAQGNLKIQSSGRVLQIAKTLLEDAGRYTCVATNAAGETQQHIQLHVHEPPS
LEDAGKMLNETVLVSNPVQLECKAAGNPVPVITWYKDNRLLSGSTSMTFLNRGQIIDIES
AQISDAGIYKCVAINSAGATELFYSLQVHVAPSISGSNNMVAVVVNNPVRLECEARGIPA
PSLTWLKDGSPVSSFSNGLQVLSGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRV
YVPPNIMGEEQNVSVLISQAVELLCQSDAIPPPTLTWLKDGHPLLKKPGLSISENGSVLK
IEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSDELTQLTVIEGNLISLLCES
SGIPPPNLIWKKKGSPVLTDSMGRVRILSGGRQLQISVAEKSDAALYSCVASNVAGTAKK
EYNLQVYIRPTITNSGSHPTEIIVTRGKSISLECEVQGIPPPTVTWMKDGRPLIKAKGVE
ILDEGHILQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAPPSIIGNHRSPENISVVE
KNSVSLTCEASGIPLPSITWFKDGWPVSLSNSVRILSGGRMLRLMQTTMEDAGQYTCVVR
NAAGEERKIFGLSVLVPPHIVGENTLEDVKVKEKQSVMLTCEVTGNPVPEITWHKDGQPL
QEDEAHHIISGGRFLQITNVQVPHTGRYTCLASSPAGDKSRSFSLNVFVSPTIAGVGSDG
NPEDVTVILNSPTSLVCEAYSYPPATITWFKDGTPLESNRNIRILPGGRTLQILNAQEDN
AGRYSCVATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYA
IPSASLSWYKDGQPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDV
NIQVPPSFQKLWEIGNMLDTGRNGEAKDVIINNPISLYCETNAAPPPTLTWYKDGHPLTS
SDKVLILPGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLVPPIIKGANSDLPE
EVTVLVNKSALIECLSSGSPAPRNSWQKDGQPLLEDDHHKFLSNGRILQILNTQITDIGR
YVCVAENTAGSAKKYFNLNVHVPPSVIGPKSENLTVVVNNFISLTCEVSGFPPPDLSWLK
NEQPIKLNTNTLIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKKFSLTVYVPPSIKD
HDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMITESTHVEILADGQMLHIKKA
EVSDTGQYVCRAINVAGRDDKNFHLNVYVPPSIEGPEREVIVETISNPVTLTCDATGIPP
PTIAWLKNHKRIENSDSLEVHILSGGSKLQIARSQLSDSGNYTCIASNMEGKAQKYYFLS
IQVPPSVAGAEIPSDVSVLLGENVELVCNANGIPTPLIQWLKDGKPIASGETERIRVSAN
GSTLNIYGALTSDTGKYTCVATNPAGEEDRIFNLNVYVTPTIGGNKDEAEKLMTLVDTSI
NIECRATGTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIVRAQVSDVAVYTCVASNRAG
VDNKHYNLQVFAPPNMDNSMRTEEITVLKGSSTSMACITDGTPAPSMAWLRDGQPLGLDA
HLTVSTHGMVLQLLKAETEDSGKYTCIASNEAGEVSKHFILKVLEPPHINGSEEHEEISV
IVNNPLELTCIASGIPAPKMTWMKDGRPLPQTDQVQTLGGGEVLRISTAQVEDTGRYTCL
ASSPAGDDDKEYLVRVHVPPNIAGTDEPQDITVLRNRQVTLECKSDAVPPPVITWLRNGE
RLQATPRVRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKGGPQ
SLVILLNKSTVLECIAEGVPTPRITWRKDGAVLAGNHARYSILENGFLHIQSAHVTDTGR
YLCMATNAAGTDRRRIDLQVHVPPSIAPGPTNMTVIVNVQTTLACEATGIPKPSINWRKN
GHLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNGAGDDKRTVDLTVQVPPSIA
DEPTDFLVTKHAPAVITCTASGVPFPSIHWTKNGIRLLPRGDGYRILSSGAIEILATQLN
HAGRYTCVARNAAGSAHRHVTLHVHEPPVIQPQPSELHVILNNPILLPCEATGTPSPFIT
WQKEGINVNTSGRNHAVLPSGGLQISRAVREDAGTYMCVAQNPAGTALGKIKLNVQVPPV
INPHLKEYVIAVDKPITLSCEADGLPPPDITWHKDGRAIVESIRQRVLSSGSLQIAFVQP
GDAGHYTCMAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAI
NWKKDNVLLANLLGKYTAEPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLP
TFTELPGDVSLNKGEQLRLSCKATGIPLPKLTWTFNNNIIPAHFDSVNGHSELVIERVSK
EDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPTPT
IQWNRKGVDIEISHRIRQLGNGSLAIYGTVNEDAGDYTCVATNEAGVVERSMSLTLQSPP
IITLEPVETVINAGGKIILNCQATGEPQPTITWSRQGHSISWDDRVNVLSNNSLYIADAQ
KEDTSEFECVARNLMGSVLVRVPVIVQVHGGFSQWSAWRACSVTCGKGIQKRSRLCNQPL
PANGGKPCQGSDLEMRNCQNKPCPVDGSWSEWSLWEECTRSCGRGNRTRTRTCNNPSVQH
GGRPCEGNAVEIIMCNIRPCPVHGAWSAWQPWGTCSESCGKGTQTRARLCNNPPPAFGGS
YCDGAETQMQVCNERHCPIHGKWATWASWSACSVSCGGGARQRTRDCSDPVPQYGGRKCE
GSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPPPSNGGRACGGPD
SQIQRCNTDMCPVDGSWGSWHSWSQCSASCGGGEKTRKRLCDHPVPIKGGRPCPGDTTQV
TRCNVQACPGGPQRARGSVIGNINDVEFGIAFLNATITDSPNSDTRIIRAKITNVPHSLG
SAMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFATGEILQMSHIARGLDS
DGALLLDIVVSGYVLQLQSPAEVTVKDYTEDYIQTGPGQLYAYSTRLFTIDGISIPYTWN
HTVFYDQAQGRMPFLVETLHASSVESDYNQIEETLGFKIHASISKGDRSNQCPSGFTLDS
VGPFCADEDECAAGNPCSHTCHNAMGTYYCSCPKGLTIAADGRTCQDIDECALGRHTCHA
GQDCDNTIGSYRCVVRCGSGFRRTSDGLSCQDINECQESSPCHQRCFNAIGSFHCGCEPG
YQLKGRKCMDVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGMTKAENGTCIDIDECKDGT
HQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCMDINECEQVPKPCAHQCSNTPGSFKCI
CPPGQHLLGDGKSCAGLERLPNYGTQYSSYNLARFSPVRNNYQPQQHYRQYSHLYSSYSE
YRNSRTSLSRTRRTIRKTCPEGSEASHDTCIDIDECENTDACQHECKNTFGSYQCICPPG
YQLTHNGKTCQDIDECLEQNVHCGPNRMCFNMRGSYQCIDTPCPPNYQRDPVSGFCLKNC
PPNDLECALSPYALEYKLVSLPFGIATNQDLIRLVAYTQDGVMHPRTTFLMVDEEQTVPF
ALRDENLKGVVYTTRPLREAETYRMRVRASSYSANGTIEYQTTFIVYIAVSAYPY
Download sequence
Identical sequences ENSPTRP00000002974 ENSPTRP00000002974 9598.ENSPTRP00000002974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]