SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000002992 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000002992
Domain Number 1 Region: 404-476
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000262
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000002992   Gene: ENSPTRG00000001788   Transcript: ENSPTRT00000003248
Sequence length 766
Comment pep:known chromosome:CHIMP2.1.4:1:168702045:169092477:-1 gene:ENSPTRG00000001788 transcript:ENSPTRT00000003248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWRSRAGAELFSLMALWEWIALSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEY
TDFVDRSRQGFSTRYKIYREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTL
QQITENLIKKYGTHFLLSATLGGEESLTIFVDKRKLSKRAEGSDSSTNSSSVTLETLHQL
AASYFIDRDSTLRRLHHIQIASTAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKIQL
QGLQVLLPDYLQERFVQAALSYIACNSEGEFICKENDCWCHCGPKFPECNCPSMDIQAME
ENLLRITETWKAYNSDFEESDEFKLFMKRLPMNYFLNTSTIMHLWTMDSNFQRRYEQLEN
SMKQLFLKAQKIVHKLFSLSKRCHKQPLISLPRQRTSTYWLTRIQSFLYCNENGLLGSFS
EETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTRCGTCNTGYMLSQGLCKPEVAE
STDHYIGFETDLQDLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSN
KYKSSLVHMILGLSLQICLTKNSTLEPVLAVYVNPFGGSHSESWFMPVNENSFPDWERTK
LDLPLQCYNWTLTLGNKWKTFFETVHIYLRSRIKSNGPNGNESIYYEPLEFIDPSRNLGY
MKINNIQVFGYSMHFDPEAIRDLILQLDYPYTQGSQDSALLQLLEIRDRVNKLSPPGQRR
LDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTMDYDTTKLCS
Download sequence
Identical sequences G3QZJ0 H2Q0T1
9598.ENSPTRP00000002992 XP_003820636.1.60992 XP_008972277.1.60992 XP_008972278.1.60992 XP_008972279.1.60992 XP_009438057.1.37143 XP_016789853.1.37143 XP_016789860.1.37143 XP_018883629.1.27298 XP_525003.1.37143 ENSPTRP00000002992 ENSPTRP00000002992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]