SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003029 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000003029
Domain Number - Region: 9-112
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0471
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003029   Gene: ENSPTRG00000001816   Transcript: ENSPTRT00000003292
Sequence length 124
Comment pep:known chromosome:CHIMP2.1.4:1:177243743:177261536:-1 gene:ENSPTRG00000001816 transcript:ENSPTRT00000003292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSQSQGIHQLLQAEKRAKDKLEEAKKKTGTASGKGKRLKQAKEEAMVEIDQYRMQRDKE
FRLKQSKIMGSQNNLSDKIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNY
RATN
Download sequence
Identical sequences A0A2I3SJR5
ENSPTRP00000003029 9598.ENSPTRP00000003030 ENSPTRP00000003029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]