SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003044 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003044
Domain Number 1 Region: 1334-1472
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 224-324
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000249
Family Calponin-homology domain, CH-domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003044   Gene: ENSPTRG00000001822   Transcript: ENSPTRT00000003307
Sequence length 1478
Comment pep:known chromosome:CHIMP2.1.4:1:179488265:179610562:1 gene:ENSPTRG00000001822 transcript:ENSPTRT00000003307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELQEPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGGQKARYRKEQTLLKQLPCIPLVENLLKD
GTDGCALAALIHFYCPDVVRLEDICLKETMSLADSLYNLQLIQEFCQEYLNQCCHFTLED
MLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQGAEPVKDMPSIPVLNAAKRNV
LDSSSDFPSSGEGATFTQSHHHLPSRYSRPQAHSSASGGIRRSSSMSYVDGFIGTWPKEK
RSSVHGVSFDISFDKEDSVQRSTPNRGITRSISNEGLTLNNSRVSKHIRKNLSFKPINGE
EEAESIEEELNIDSHSDLKSYVPLNTNELNSNENIHYKLPNGALQNRILLDEFGNQIETP
SIEEALQIIHDTEKSPHTPQPDQIANGFFLHSQEMSILDSNIKLNQSSPDNVTDTKGALS
PITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQDYDIRTGNTREA
LSPCPSTVSTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSSSQKTTPEGSELN
IPHVVAWAQIPEETGLPQGRDTTQLLASEMVHLRMKLEEKRRAIEAQKKKMEAAFTKQRQ
KMGRTAFLTVVKKKGDGISPLREEAAGAEDEKVYTDRAKEKESQKTDGQRSKSLADIKES
MENPQAKWLKSPTTPIGPEKQWNLASPSEETLNEGEILEYTKSIEKLNSSLHFLQQEMQR
LSLQQEMLMQMREQQSWVISPPQPSPQKQIRDFKPSKQAGLSSAITPFSSDSPRPTHPSP
QSSNRKSASFSVKSQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFSPSQVPIQTRSFV
CFGDDGEPQLKESKPKEEVKKEELESKGTLEQRGHNPEEKEIKPFESTVSEVLSLPITET
VCLTPNEDQLNQPTEPPPKPVFPPTAPKNVNLIEVSLSDLKPPEKADVPVEKYDGESDKE
QFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQLEAEMEHKKEET
RRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKARPQVVKQKKQRPKSIHR
DHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEAFLSPSRCGSRNGEKD
WENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEME
KSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQF
SHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences H2Q0V2
XP_514085.2.37143 ENSPTRP00000003044 ENSPTRP00000003044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]