SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003206 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003206
Domain Number 1 Region: 199-531
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.92e-85
Family Protein kinases, catalytic subunit 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003206   Gene: ENSPTRG00000001914   Transcript: ENSPTRT00000003486
Sequence length 588
Comment pep:known chromosome:CHIMP2.1.4:1:185732640:185746410:1 gene:ENSPTRG00000001914 transcript:ENSPTRT00000003486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCPNVLCNPSEPPPPR
RLNMTTEQFTRDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKS
SDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHG
VIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMV
RNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIK
KNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSC
FEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLAC
MMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGS
KDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKR
VVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGGIPLCSVLPKLIS
Download sequence
Identical sequences H2Q103
ENSPTRP00000003206 XP_009439635.1.37143 ENSPTRP00000003206 9598.ENSPTRP00000003206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]