SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003207 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003207
Domain Number 1 Region: 59-369
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-82
Family Protein kinases, catalytic subunit 0.0000000000146
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000003207
Domain Number - Region: 19-24
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0018
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003207   Gene: ENSPTRG00000001915   Transcript: ENSPTRT00000003487
Sequence length 400
Comment pep:known chromosome:CHIMP2.1.4:1:185782903:185832256:1 gene:ENSPTRG00000001915 transcript:ENSPTRT00000003487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSNSQGQSPPVPFPAPAPPPQPPAPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
Download sequence
Identical sequences H2Q104
ENSPTRP00000003207 ENSNLEP00000000896 ENSPTRP00000003207 ENSNLEP00000000896 XP_001164988.1.37143 XP_003273010.1.23891 9598.ENSPTRP00000003207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]