SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003293 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003293
Domain Number 1 Region: 5-280
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-83
Family Protein kinases, catalytic subunit 0.000000000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003293   Gene: ENSPTRG00000001953   Transcript: ENSPTRT00000003575
Sequence length 445
Comment pep:known chromosome:CHIMP2.1.4:1:190778957:190791803:-1 gene:ENSPTRG00000001953 transcript:ENSPTRT00000003575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLR
ELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQL
TLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTP
YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSS
PVLSELKLKEIQLQERERALKAREESLEQKEQELCVRERLAEDKLARAENLLKNYSLLKE
RKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAA
QLRAQALSDIEKNYQLKSRQILGMR
Download sequence
Identical sequences H2Q134
XP_003814241.1.60992 9598.ENSPTRP00000003293 ENSPTRP00000003293 ENSPTRP00000003293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]