SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003343 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003343
Domain Number 1 Region: 197-509
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.92e-87
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000738
Further Details:      
 
Domain Number 2 Region: 1022-1289
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.74e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000668
Further Details:      
 
Domain Number 3 Region: 504-707
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 3.66e-53
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00044
Further Details:      
 
Domain Number 4 Region: 1292-1421
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.11e-29
Family Anticodon-binding domain of Class II aaRS 0.00016
Further Details:      
 
Domain Number 5 Region: 1425-1512
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 1.86e-17
Family C-terminal domain of ProRS 0.0057
Further Details:      
 
Domain Number 6 Region: 51-162
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.38e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.02
Further Details:      
 
Domain Number 7 Region: 752-805
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 1.14e-16
Family a tRNA synthase domain 0.0000505
Further Details:      
 
Domain Number 8 Region: 824-878
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 2.28e-16
Family a tRNA synthase domain 0.0001
Further Details:      
 
Domain Number 9 Region: 904-955
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000000471
Family a tRNA synthase domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003343   Gene: ENSPTRG00000001995   Transcript: ENSPTRT00000003628
Sequence length 1512
Comment pep:known chromosome:CHIMP2.1.4:1:199148667:199228065:-1 gene:ENSPTRG00000001995 transcript:ENSPTRT00000003628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLSLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLAR
VATTAGLYGSNLMEHTEIDHWLEFSATKLSSCDSFTSAINELNHCLSLRTYLVGNSLSLA
DLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEAQQAFQSVGTKWDVSTTKARVAPEK
KQDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMK
AEREQRIESKHRKNPIEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTLYRCK
IQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYI
WEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGS
SRSVVNMEWDKIWAFNKKVIDPVAPRYVALLKKEVIPVNVPEAQEEMKEVAKHPKNPEVG
LKPVWYSPKVFIEGADAETFSEGEMVTFINWGNLNITKIHKNADGKIISLDAKLNLENKD
YKKTTKITWLAETTHALPIPVICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELMLGDPC
LKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLIYIPDGHTKEMPTSGSKEKTK
VEATKNETSAPFKERPTPSLNNNCTTSEDSLVLYNRVAVQGDVVRELKAKKAPKEDVDAA
VKQLLSLKAEYKEKTGQEYKPGNPPAEIGQNISSNSSASILESKSLYDEVAAQGEVVRKL
KAEKAPKAKINEAVECLLSLKAQYKEKTGKEYIPGQPPLSQSSDSSPTRNSEPAGLETPE
AKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAED
KDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGLEAKK
EENLADWYSQVITKSEMIEYHDVSGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPM
FVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDL
PIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQVYEEL
LAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVFEDPK
IPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALSEEDK
EALIAKCNDYRRRLLRVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKSCQFV
AVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKILDSG
KIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCVCGKN
PAKYYTLFGRSY
Download sequence
Identical sequences H2Q156
ENSPTRP00000003343 ENSPTRP00000003343 XP_001172425.1.37143 9598.ENSPTRP00000003343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]