SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003354 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003354
Domain Number 1 Region: 57-312
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-96
Family Protein kinases, catalytic subunit 0.00000975
Further Details:      
 
Domain Number 2 Region: 687-795
Classification Level Classification E-value
Superfamily KA1-like 6.05e-47
Family Kinase associated domain 1, KA1 0.00000544
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000003354
Domain Number - Region: 322-370
Classification Level Classification E-value
Superfamily UBA-like 0.00246
Family UBA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003354   Gene: ENSPTRG00000002000   Transcript: ENSPTRT00000003639
Sequence length 795
Comment pep:known chromosome:CHIMP2.1.4:1:199751932:199887423:1 gene:ENSPTRG00000002000 transcript:ENSPTRT00000003639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARTPLPTVNERDTENHTSVDGYTEPLIQPTKSSSRQNIPRCRNSITSATDEQPHIGNY
RLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIV
KLFEVIESEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVH
RDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDV
WSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRG
SLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDE
VMATYILLGRKPPEFEVGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQR
RFSDHAGPSIPPAVSYTKRPQANSVESEQKEEWDKDVARKLGSTTVGSKSEMTASPLVGP
ERKKSSTIPSNNVYSGGSMARRNTYVCERTTDRYTALQNGKDSSLTEMSVSSISSAGSSV
ASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPD
RTRFPRGSSSRSTFHGEQLRERRSAAYNGPPASPSHETGAFAHARRGTSTGIISKITSKF
VRRDPSEGEASGRTDTSRSTSGEPKERDKEEGKDSKPRSLRFTWSMKTTSSMDPNDMMRE
IRKVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSI
AFKNIASKIANELKL
Download sequence
Identical sequences 9598.ENSPTRP00000003354 ENSPTRP00000003354 ENSPTRP00000003354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]