SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003583 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003583
Domain Number 1 Region: 101-397
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.37e-75
Family Protein kinases, catalytic subunit 0.0000186
Further Details:      
 
Domain Number 2 Region: 43-117
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-17
Family SH3-domain 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000003583
Domain Number - Region: 410-481
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0247
Family Regulator of G-protein signaling, RGS 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003583   Gene: ENSPTRG00000002119   Transcript: ENSPTRT00000003877
Sequence length 1035
Comment pep:known chromosome:CHIMP2.1.4:1:212478854:212537837:1 gene:ENSPTRG00000002119 transcript:ENSPTRT00000003877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLPGAAGAADTPVSLAGGAPGGSASLLSTSLGGLASAGAGLWAALYDYEARGEDELSLR
RGQLVEVLSQDAAVSGDEGWWAGQVQRRLGIFANYVAPCRPAASPAPPPPRPSSPVHVAF
ERLELKELIGAGGFGQVYRATWQGQEVAVKAARQDPEQDAAAAAESVRREARLFAMLRHP
NIIELRGVCLQQPHLCLVLEFARGGALNRALAAANAAPDPRAPGPRRARRIPPHVLVNWA
VQIARGMLYLHEEAFVPILHRDLKSSNILLLEKIEHDDICNKTLKITDFGLAREWHRTTK
MSAAGTYAWMAPEVIKSSLFSKGSDIWSYGVLLWELLTGEVPYRGIDGLAVAYGVAVNKL
TLPIPSTCPEPFAKLMKECWQQDPHIRPSFALILEQLTAIEGAVMTEMPQESFHSMQDDW
KLEIQQMFDELRTKEKELRSREEELTRAALQQKSQEELLKRREQQLAEREIDVLERELNI
LIFQLNQEKPKVKKRKGKFKRSRLKLKDGHRISLPSDFQHKITVQASPNLDKRRSLNSSS
SSPPSSPTMMPRLRAIQLTSDESNKTWGRNTVFRQEEFEDVKRNFKKKGCTWGPNSIQMK
DRTDCKERIRPLSDGNSPWSTILIKNQKTMPLASLFVDQPGSCEEPKLSPDGLEHRKPKQ
IKLPSQAYIDLPLGKDAQRENPAEAESWEEAASANAATVSIEMTPTNSLSRSPQRKKTES
ALYGCTVLLASVALGLDLRELHKAQAAEEPLPKEEKKKREGIFQRASKSRRSASPPTRLP
STGGEASSPPSLPLSSALGILSTPSLSTKCLLQMDSEDPLVDSAPVTCDSEMLTPDFCPT
APGSGREPALMPRLDTDCSVSRNLPSSFLQQTCGNVPYCASSKHRPSHHRRTMSDGNPTP
TGATIISATGASALPLCPSPAPHSHLPREVSPKKHSTVHIVPQRRPASLRSRSDLPQAYP
QIAVSQLAQTACVVGRPGPHPTQFLAAKERTKSHVPSLLDADVEGQSRDYTVPLCRMRSK
TSRPSIYELEKEFLS
Download sequence
Identical sequences 9598.ENSPTRP00000003583 ENSPTRP00000003583 ENSPTRP00000003583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]