SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003607 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003607
Domain Number 1 Region: 429-660
Classification Level Classification E-value
Superfamily GFP-like 2.51e-91
Family Domain G2 of nidogen-1 0.00000000139
Further Details:      
 
Domain Number 2 Region: 943-1179
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-46
Family YWTD domain 0.000000000824
Further Details:      
 
Domain Number 3 Region: 811-919
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.01e-25
Family Thyroglobulin type-1 domain 0.00053
Further Details:      
 
Domain Number 4 Region: 762-841,877-890,1200-1244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.79e-19
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 5 Region: 385-426,671-769
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000204
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003607   Gene: ENSPTRG00000002135   Transcript: ENSPTRT00000003903
Sequence length 1247
Comment pep:known chromosome:CHIMP2.1.4:1:215274825:215365488:-1 gene:ENSPTRG00000002135 transcript:ENSPTRT00000003903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASSSRIRAAWTRALLLPLLLAGPVGCLSRQELFPFGPGQGDLELEDGDDLVSPALELS
GALRFYDRSDIDSVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKV
YYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSRDPDQKGKRNTFQ
AVLASSDSSSYAIFLYPEDGLQFHTTFSKKENNQVPAVVAFSQGSVGFLWKSNGAYNIFA
NDRESIENLAKSSNSGQQGVWVFEIGSPVTTNGVVPADVILGTEDGAEYDDEDEDYDLAT
TRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPRRAATERPLGPPTERTRSFQLAVETF
HQQQPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG
NGRQCVAEGSPQRVNGKVKGRIFVGSSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETV
GYSLLPLAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGNLVIKQRFSGI
DEHGHLTIDTELEGRVPQIPFGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPERDGAS
PSRIYTYQWRQTITFQECVHDDSRPALPSTQQLSVDSVFVLYNQEEKILRYALSNSIGPV
REGSPDALQNPCYLGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSV
CGSHTICNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCETGLHNCDIPQRARCIYT
GGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV
PGEVEKTRCQHEREHILGAAGAADPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVD
RDGREVEGTRTRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLE
GNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIIRQDL
GSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYW
TDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDVFSSQLCWVDAGTNRAECLNPSQ
PSRRKALEGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITT
ALSQCPRGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Download sequence
Identical sequences H2Q1E0
9598.ENSPTRP00000003607 XP_001156001.1.37143 ENSPTRP00000003607 ENSPTRP00000003607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]