SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003621 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003621
Domain Number 1 Region: 15-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-87
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 274-396
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 510-613
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-27
Family Spectrin repeat 0.00000145
Further Details:      
 
Domain Number 4 Region: 391-506
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-24
Family Spectrin repeat 0.000000481
Further Details:      
 
Domain Number 5 Region: 694-822
Classification Level Classification E-value
Superfamily EF-hand 3.89e-22
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 
Domain Number 6 Region: 622-701
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000592
Family Spectrin repeat 0.0000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003621   Gene: ENSPTRG00000002144   Transcript: ENSPTRT00000003920
Sequence length 849
Comment pep:known chromosome:CHIMP2.1.4:1:215998596:216074768:1 gene:ENSPTRG00000002144 transcript:ENSPTRT00000003920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVN
DRCQKICDQWDRLGTLTQKRREALERMEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYS
TVTMDELRTKWDKEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEA
LVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHF
DRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADT
DTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYTAFS
SALYGESDL
Download sequence
Identical sequences ENSPTRP00000003621 ENSPTRP00000003621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]