SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000003786 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000003786
Domain Number 1 Region: 152-226
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000000104
Family Double-stranded RNA-binding domain (dsRBD) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000003786   Gene: ENSPTRG00000002241   Transcript: ENSPTRT00000004102
Sequence length 619
Comment pep:novel chromosome:CHIMP2.1.4:10:1274280:1829410:-1 gene:ENSPTRG00000002241 transcript:ENSPTRT00000004102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVLGSGRGSGGLNSQLKCKSKRRRRRRSKRKDKVSILSTFLAPFKHLSPGITNTEDDD
TLAELLRSFVQFPNACQAHLAMGGGPGPGTDFTSDQADFPDTLFQEFEPPAPRPGLAGGR
PGDAALLSAAYGRRRLLCRALDLVGPTPATPAAPGERNPVVLLNRLRAGLRYVCLAEPAE
RRARSFVMAVSVDGRTFEGSGRSKKLARGQAAQAALQALFDIQMPGHAPGRARRTPMPQE
FADSISQLVTQKFREVTTDLTPMHARHKALAGIVMTKGLDARQAQVVALSSGTKCISGEH
LSDQGLVVNDCHAEVVARRAFLYFLYTQLELHLSKRREDSERSIFVRLKEGGYRLRENIL
FHLYVSTSPCGDARLHSPYEITTDLHSSKHLVRKFRGHLRTKIESGEGTVPVRGPSAVQT
WDGVLLGEQLITMSCTDKIARWNVLGLQGALLSHFVEPVYLQSIVVGSLHHTGHLARVMS
HRMEGVGQLPASYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSC
GGPSRLCKHVLSARWARLYGRLSTRTPSPGDTPSMYCEAKLGAHTYQSVKQQLFKAFQKA
GLGTWVRKPPEQQQFLLTL
Download sequence
Identical sequences ENSPTRP00000003786 9598.ENSPTRP00000003786 ENSPTRP00000003786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]