SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004014 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004014
Domain Number 1 Region: 335-889,922-1104
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-236
Family Motor proteins 0.00000000148
Further Details:      
 
Domain Number 2 Region: 12-294
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-82
Family Protein kinases, catalytic subunit 0.00000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004014   Gene: ENSPTRG00000002371   Transcript: ENSPTRT00000004350
Sequence length 1613
Comment pep:known chromosome:CHIMP2.1.4:10:26335077:26618795:1 gene:ENSPTRG00000002371 transcript:ENSPTRT00000004350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPLIGKTIIFDNFPDPSDTWEITETIGKGTYGKVFKVLNKKNGQKAAVKILDPIHDIDE
EIEAEYNILKALSDHPNVVRFYGIYFKKDKVNGDKLWLVLELCNGGSVTDLVKGFLKRGE
RMSEPLIAYILHEALMGLQHLHNNKTIHRDVKGNNILLTTEGGVKLVDFGVSAQLTSTRH
RRNTSVGTPFWMAPEVIACEQQLDTTYDARCDTWSLGITAIELGDGDPPLADLHPMRALF
KIPRNPPPKLRQPELWSAEFNDFISKCLTKDYEKRPTVSELLQHKFITQIEGKDVMLQKQ
LMEFIGIHQCMGGTEKARHERIHTKKGNFNRPLISNLKDVDDLATLEVLDENTVSEQLEK
CYSRDQIYIYVGDILIALNPFQSLGLYSTKHSKLYIGSKRTASPPHIFAMADLGYQSMIT
YNSDQCIVISGESGAGKTENAHLLVQQLTVLGKANNRTLQEKILQVNNLVEAFGNACTII
NDNSSRFGKYLEMKFTSSGAVVGAQISEYLLEKSRVIHQAIGEKNFHIFYYIYAGLAEKK
KLAHYKLPENKPPRYLQNDHLRTVQDIMNNSFYKSQYELIEQCFKVIGFTMEQLGSIYSI
LAAILNVGNIEFSSVATEHQIDKSHISHHTALENCASLLCIRADELQEALTSHCVVTRGE
TIIRPNTVEKATDVRDAMAKTLYGRLFSWIVNCINSLLKHDSSPSGNGDELSIGILDIFG
FENFKKNSFEQLCINIANEQIQYYYNQHVFAWEQNEYLNEDVDARVIEYEDNRPLLDMFL
QKPMGLLSLLDEESRFPKATDQTLVEKFEGNLKSQYFWRPKRMELSFGIHHYAGKVLYNA
SGFLAKNRDTLPTDIVLLLRSSDNSVIRQLVNHPLTKTGNLPHSKTKNVINYQMRTSEKL
INLAKGDTGEATRHARETTNMKTQTVASYFRYSLMDLLSKMVVGQPHFVRCIKPNNERQA
RKYDKEKVLLQLRYTGILETARIRRLGFSHRILFANFIKRYYLLCYKSSEEPRMSPDTCA
TILEKAGLDNWALGKTKVFLKYYHVEQLNLMRKEAIDKLILIQACVRAFLCSRRYQKIQE
KRKESAIIIQSAARGHLVRKQRKEIVNMKNTAVTTIQTSDQEFNYKKNFENTRESFVKKQ
AENAISANERFISAPNNKGSVSVVKTSTFKPEEETPIAVESNNRVYQTPKKMNNVYEEEV
KQEFYLVGPEVSPKQKSVKDLEENSNLRKVEKEEAMIQSYYQRYIEERNCEESKAAYLER
KAISERSSYPVPWLAENETSFKKTLEPTLSQRSIYQNANSMEKEKKTSVVTQSAPICSQE
EGRGRLRHETVKEKQVEPVTQAQEEEDKAAVFIQSKYRGYKRRQQLRKDKMSSFKHQRIV
TTPTEVARNTHNLYSYPTKHEEINNIKKKDNKDSKATSEREACDLAIFSKQISKLSEEYF
ILQKKLNEMILSQQLKPLYLGVSHHKPINRRVSSQQCLSKILRPPRRPRKPKTLNNPEDS
TYYYLLHKSIQEEKRRPRKDSQGKLLDLEDFYYKEFLPSRSGPKEHSPSLRERRPQQELQ
NQCIKANERCWAAESPEKEEEEKEEEREPAANPYDFRRLLRKTSQRRRLVQQS
Download sequence
Identical sequences ENSPTRP00000004014 ENSPTRP00000004014 9598.ENSPTRP00000004014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]