SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004070 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004070
Domain Number 1 Region: 141-400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-65
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004070   Gene: ENSPTRG00000002400   Transcript: ENSPTRT00000004410
Sequence length 467
Comment pep:known chromosome:CHIMP2.1.4:10:30896171:30924096:1 gene:ENSPTRG00000002400 transcript:ENSPTRT00000004410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERS
KSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGR
YQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVE
IQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPG
MRELIEAALERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALFERKRLLSRKELELP
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG
Download sequence
Identical sequences A0A0D9RZU2 A0A2I3LEE9 A0A2K5MGE1 A0A2K6ACH6 A0A2K6RPG4 F7CDF3 G3QS35 G7PEP4 H2Q1S6
ENSPTRP00000004070 XP_001137315.1.37143 XP_001137395.1.37143 XP_003821494.1.60992 XP_003821495.1.60992 XP_008017783.1.81039 XP_008017784.1.81039 XP_008017785.1.81039 XP_008973163.1.60992 XP_009456474.1.37143 XP_010355342.1.97406 XP_010355343.1.97406 XP_011832712.1.47321 XP_011832713.1.47321 XP_011939995.1.92194 XP_011939996.1.92194 XP_011939997.1.92194 XP_011939998.1.92194 XP_011939999.1.92194 XP_011940000.1.92194 XP_011940001.1.92194 XP_011940002.1.92194 XP_011940003.1.92194 XP_014201882.1.60992 XP_015002205.1.72884 XP_015002206.1.72884 XP_016818374.1.37143 XP_018891149.1.27298 XP_018891150.1.27298 9598.ENSPTRP00000004070 ENSPTRP00000004070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]