SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004497 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004497
Domain Number 1 Region: 259-461
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.89e-48
Family Reprolysin-like 0.0016
Further Details:      
 
Domain Number 2 Region: 555-605
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000575
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 974-1024
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000981
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 912-971
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 850-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000122
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004497   Gene: ENSPTRG00000002596   Transcript: ENSPTRT00000004876
Sequence length 1226
Comment pep:known chromosome:CHIMP2.1.4:10:69180116:69266657:1 gene:ENSPTRG00000002596 transcript:ENSPTRT00000004876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLRALLSCLLPLHCALCAAAGSRTPELHLSGKLSDYGVTVPCSTDFRGRFLSHVVSGP
AAASAGSMVVDTPPTLPRHSSHLRVARSPLHPGGTLWPGRVGRHSLYFNVTVFGKELHLR
LRPNRRLVVPGSSVEWQEDFRELFRQPLRQECVYTGGVTGMPGAAVAISNCDGLAGLIRT
DSTDFFIEPLERGQQEKEASGRTHVVYRREAVQQEWAEPHGDLHNEAFGLGDLPNLLGLV
GDQLGDTERKRRHAKPGSYSIEVLLVVDDSVVPFHGKEHVQNYVLTLMNIVDEIYHDESL
GVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLT
RQDFGPSGMQGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCAD
ETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYS
MDEQCRFDFGSGFQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFK
GHCIWKSPEQTYGQDGGWSSWTKFGSCSRSCGGGVRSRSRSCNNPSPAYGGRPCLGPMFE
YQVCNSEECPGTYEDFRAQQCAKRNSYYVHQNAKHSWVPYEPDDDAQKCELICQSADTGD
VVFMNQVVHDGTRCSYRDPYSVCARGECVPVGCDKEVGSMKADDKCGVCGGDNSHCRTVK
GTLGKASKQAGALKLVQIPAGARHIQIEALEKSPYRIVVKNQVTGSFILNPKGKEATSRT
FTAMGLEWEDAVEDAKESLKTSGPLPEAIAILALPPTEGGPRSSLAYKYVIHEDLLPLIG
SNNVLLEEMDTYEWALKSWAPCSKACGGGIQFTKYGCRRRRDHHMVQRHLCDHKKRPKPI
RRRCNQHPCSQPVWVTEEWGACSQSCGKLGVQTRGIQCLLPLSNGTHKVMPAKACAGDRP
EARRPCLRVPCPAQWRLGAWSQCSATCGEGIQQRQVVCRTNANSLGHCEGDRPDTVQVCS
LPTCGGNRQNSTVRADVWELGTPEGQWVPQSGPLHPINKISSTEPCMGDRSVFCQMEVLD
RYCSIPGYHRLCCVSCIKKASGPNPGPDPGPTSLPSFSTPGSPLPGPQDPADAAEPPGKP
TGSEDHQHGRATQLPGALDTSSPGTQHPFAPETPIPGASWSISPTTPGGLPWGWTQTPTP
VPEDKGQPGEDLRHPGTSLPAASPVT
Download sequence
Identical sequences ENSPTRP00000004497 9598.ENSPTRP00000004497 ENSPTRP00000004497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]