SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000004727 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000004727
Domain Number 1 Region: 210-521
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-73
Family Protein kinases, catalytic subunit 0.0000000018
Further Details:      
 
Domain Number 2 Region: 58-139
Classification Level Classification E-value
Superfamily Snake toxin-like 2.56e-19
Family Extracellular domain of cell surface receptors 0.00000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000004727   Gene: ENSPTRG00000002706   Transcript: ENSPTRT00000005116
Sequence length 532
Comment pep:known chromosome:CHIMP2.1.4:10:86203012:86373800:1 gene:ENSPTRG00000002706 transcript:ENSPTRT00000005116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSNQKKSENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYC
KSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
Download sequence
Identical sequences H2Q272
ENSPTRP00000004727 9598.ENSPTRP00000004727 ENSPTRP00000004727 XP_016774288.1.37143 XP_016774289.1.37143 XP_016774290.1.37143 XP_016774291.1.37143 XP_016774292.1.37143 XP_016774293.1.37143 XP_016774294.1.37143 XP_016774295.1.37143 XP_507889.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]