SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005404 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005404
Domain Number 1 Region: 90-412
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-79
Family Protein kinases, catalytic subunit 0.00000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005404   Gene: ENSPTRG00000003074   Transcript: ENSPTRT00000005842
Sequence length 486
Comment pep:known chromosome:CHIMP2.1.4:10:132014139:132118017:-1 gene:ENSPTRG00000003074 transcript:ENSPTRT00000005842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSGAERRGSSAAASPGSPPPGRARPAGSDAPSALPPPAAGQPRARDSGDVRAQPRPLFQ
WSKWKKRMGSSMSAATARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYA
MKYMNKQQCIERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRY
HLQQNVQFSEDTVRLYICEMALALDYLRGQHIIHRDVKPDNILLDERGHAHLTDFNIATI
IKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRPYDIHSS
NAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQDVQAAPALAGVLWDH
LSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEND
YLQDCLDAIQQDFVIFNREKLKRSQDFPSEPLPAPESRDAAEPVEDEAERSALPMCGPIC
PSAGSG
Download sequence
Identical sequences H2Q2T0
ENSPTRP00000005404 XP_508118.2.37143 ENSPTRP00000005404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]