SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005885 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005885
Domain Number 1 Region: 386-620
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.07e-38
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 86-239,384-468
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.15e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.079
Further Details:      
 
Domain Number 3 Region: 991-1024
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000371
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 1025-1054
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000627
Family LIM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005885   Gene: ENSPTRG00000003370   Transcript: ENSPTRT00000006377
Sequence length 1121
Comment pep:novel chromosome:CHIMP2.1.4:11:11988801:12115999:1 gene:ENSPTRG00000003370 transcript:ENSPTRT00000006377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLEYRNFYSKLKSKVTTW
KVKVLWYKLDKRGSHEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDSF
SRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVNV
EFVKLEPPEDQENQKIGWRAEFLPTDHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGKLA
IAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFVMT
AKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNHYG
QPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFDTA
WMVKSWNQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVRPH
QVKHLYITKELEHYPLERLGSVRRSVNLSRKESDIRPSKLLTWCQQQTEGYQHVNVTDLT
TSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMASA
REPDKLSMVMYLSKFYELFQGTPLRPVDSWRKNYGENADLSLAKSSISNNYLNLTFPRKR
TPRVDGQTGENDMNKRRRKGFNNLDEPSNFSSRSLGSNQECGSSKEGGNQNKVKSMANQL
LAKFEESTRNPSLMKQERRVSGIGKPVLCSSSGPPVHSCCPKPEEATPSPSPPLKRQFPS
VVVTGHVLRELKQVSAGSECLSRPWRARAKSDLQLGGTENFATLPSTRPRAQALSGVLWR
LQQVEEKILQKRAQNLANREFHTKNIKEKAAHLASMFGHGDFPQNKLLSKGLSHTHPPSP
PSRLPSPDPAASSSPSTVDSASPARKVVVLNNLLSPFPVSSASALGLTVGKVSSGIGAAA
EVLVNLYMNDHRPKAQATSPDLESMRKSFPLNLGGSDTCYFCKKRVYVMERLSAEGHFFH
RECFRCSICATTLRLAAYTFDCDEGKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQ
EQEAPRRDTPTESSCAVAAIGTPEGSPPVHFSLPVLQPLLG
Download sequence
Identical sequences ENSPTRP00000005885 ENSPTRP00000005885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]