SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005889 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005889
Domain Number 1 Region: 11-202,248-358
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.89e-53
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005889   Gene: ENSPTRG00000003373   Transcript: ENSPTRT00000006383
Sequence length 360
Comment pep:known chromosome:CHIMP2.1.4:11:12231286:12385126:1 gene:ENSPTRG00000003373 transcript:ENSPTRT00000006383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSPTPKSPPSRKKDDSFLGKIGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPED
TMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKL
FEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILH
LLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDT
LFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHS
FFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
Download sequence
Identical sequences ENSPTRP00000005889 ENSPTRP00000005889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]