SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000005961 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000005961
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily UBC-like 1.13e-42
Family UEV domain 0.000000191
Further Details:      
 
Domain Number 2 Region: 323-383
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.79e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000005961
Domain Number - Region: 151-210
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00288
Family beta-sandwich domain of Sec23/24 0.029
Further Details:      
 
Domain Number - Region: 236-313
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00466
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000005961   Gene: ENSPTRG00000003424   Transcript: ENSPTRT00000006464
Sequence length 390
Comment pep:known chromosome:CHIMP2.1.4:11:18269720:18317121:-1 gene:ENSPTRG00000003424 transcript:ENSPTRT00000006464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPP
NPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRW
RMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSS
ALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFL
KHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences A0A0D9QYD5 A0A2I3N4L1 A0A2I3SDN5 A0A2K5ZAD9 A0A2K6DP04 A0A2K6NCD4 G1S7V5 G3R4B1 G7NDS4 G7PQL3 Q99816
9598.ENSPTRP00000005961 9606.ENSP00000251968 ENSGGOP00000010107 ENSP00000251968 gi|5454140|ref|NP_006283.1| ENSP00000251968 NP_001182410.1.72884 NP_006283.1.87134 NP_006283.1.92137 XP_001173373.1.37143 XP_003254347.1.23891 XP_003818285.1.60992 XP_004050841.1.27298 XP_005578500.1.63531 XP_008002905.1.81039 XP_010368476.1.97406 XP_011748514.1.29376 XP_011848302.1.47321 XP_016776037.1.37143 ENSPANP00000012027 ENSPTRP00000005961 ENSGGOP00000010107 ENSNLEP00000021594 ENSPTRP00000005961 ENSP00000349721 ENSNLEP00000021594 HR4715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]