SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006610 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006610
Domain Number 1 Region: 30-364
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-87
Family Protein kinases, catalytic subunit 0.00000000199
Further Details:      
 
Domain Number 2 Region: 416-700
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-74
Family Protein kinases, catalytic subunit 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006610   Gene: ENSPTRG00000003839   Transcript: ENSPTRT00000007164
Sequence length 772
Comment pep:known chromosome:CHIMP2.1.4:11:62282204:62295266:1 gene:ENSPTRG00000003839 transcript:ENSPTRT00000007164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDEDDDESCAVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKTGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVNLHEVHHDQLHTY
LVLELLRGGELLEHIRKKRHFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPGVPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRGSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVKNAPLAKRRKQKLRSATASRRGSPAPANPGRAPVAAKGAPRRANGPLPPS
Download sequence
Identical sequences ENSPTRP00000006610 ENSPTRP00000006610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]