SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006683 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006683
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000771
Family Ubiquitin-related 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006683   Gene: ENSPTRG00000038889   Transcript: ENSPTRT00000007246
Sequence length 112
Comment pep:known chromosome:CHIMP2.1.4:11:63397207:63408561:1 gene:ENSPTRG00000038889 transcript:ENSPTRT00000007246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVAYMRARELHTLEVTGLETVAQSKAHVASLEGLISEDKVVLLAGSPLQNEATLGQCGVE
ALTTLEVVGRRLGGNNCLSLQVNPVQPARYLWTTLHSSKQGEPNSSANHRCS
Download sequence
Identical sequences ENSPTRP00000006683 ENSPTRP00000006683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]