SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006892 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006892
Domain Number 1 Region: 169-386
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.36e-36
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 621-720
Classification Level Classification E-value
Superfamily PDZ domain-like 1.05e-19
Family PDZ domain 0.0000279
Further Details:      
 
Domain Number 3 Region: 1781-1847
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 4 Region: 521-593
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-18
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006892   Gene: ENSPTRG00000004007   Transcript: ENSPTRT00000007471
Sequence length 1849
Comment pep:known chromosome:CHIMP2.1.4:11:68201925:68881972:-1 gene:ENSPTRG00000004007 transcript:ENSPTRT00000007471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSPTSSEDEMAQSFSDYSVGSESDSSKEETIYDTIRATAEKPGGARMEESQSNTLVIR
VVIHDLQQTKCIRFNPDATVWVAKQRILCTLTQSLKDVLNYGLFQPASNGRDGKFLDEER
LLREYPQPVGEGVPSLEFRYKKRVYKQASLDEKQLAKLHTKTNLKKCMDHIQHRLVEKIT
KMLDRGLDPNFHDLETGETPLTLAAQLDDSVEVIKALKNGGAHLDFRAKDGMTALHKAAR
ARNQVALKTLLELGASPDYKDSYGLTPLYHTAIVGGDPYCCELLLHEHATVCCKDENGWH
EIHQACRYGHVQHLEHLLFYGADMSAQNASGNTALHICALYNQVSAERLRVSWHVLLAEL
KQYKKLGERGVAIIAGNFELAEYIKNHKETDIVPFREAPAYSNRRRRPPNTLAAPRVLLR
SNSDNNLNASAPDWAVCSTATSHRSLSPQLLQQMPSKPEGAAKTIGSYVPGPRSRSPSLN
RLGGAGEDGKRPQPLWHVGSPFALGANKDSLSAFEYPGPKRKLYSAVPGRLFVAVKPYQP
QVDGEIPLHRGDRVKVLSIGEGGFWEGSARGHIGWFPAECVEEVQCKPRDSQAETRADRS
KKLFRHYTVGSYDSFDTSSDCIIEEKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAF
PALQYLESVDEGGVAWQAGLRTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLVLKVVTV
TRNLDPDDTARKKAPPPPKRAPPQPSPCAQSMTSELEELGNSNPHGSIADKPEEIVPASK
PSRAAENMAVEPRVATIKQRPSSRCFPAGSDMNSVYERQGIAVMTPTVPGSPKAPFLGIP
RGTMRRQKSIDSRIFLSGITEEERQFLAPPMLKFTRSLSMPDTSEDIPPPPQSVPPSPPP
PSPTTYNCPKSPTPRVYGTIKPAFNQNSAAKVSPATRSDTVATMMREKGMYFRRELDRYS
LDSEDLYSRNAGPQANFRNKRGQMPENPYSEVGKIASKAVYVPAKPARRKGMLVKQSNVE
DSPEKTCSIPIPTIIVKEPSTSSSGKSSQGSSMEIDPQAPEPPSQLRPDESLTVSSPFAA
AIAGAVRDREKRLEARRNSPAFLSTDLGDEDVGLGPPAPRTRPSMFPEEGDFADEDSAEQ
LSSPMPSATPREPENHFVGGAEASAQGEAGRPLNSTSKAQGPESSPAVPSASSGTAGPGN
YVHPLTGRLLDPSSPLALALSARDRAMKESQQGPKGEAPKADLNKPLYIDTKMRPSLDAG
FPTVTRQNTRGPLRRQETENKYETDLGRDRKGDDKKNMLIDIMDTSQQKSAGLLMVHTVD
ATKLDNALQEEDEKAEVEMKPDSSPSEVPEGVSETEGALQISAAPEPTTVPGRTIVAVGS
MEEAVILPFRIPPPPLASVDLDEDFIFTEPLPPPLEFANSFDIPDDRAASVPALSDLVKQ
KKSDTPQSPSLNSSQPTNSADSKKPASLSNCLPASFLPPPESFDAVADSGIEEVDSRSSS
DHHLETTSTISTVSSISTLSSEGGENVDTCTVYADGQAFMVDKPPVPPKPKMKPIIHKSN
ALYQDALVEEDVDSFVIPPPAPPPPPGSAQPGMAKVLQPRTSKLWGDVTEIKSPILSGPK
ANVISELNSILQQMNREKSAKPGEGLDSPMGAKSASLAPRSPEIMSTISGTRSTTVTFTV
RPGTSQPITLQSRPPDYESRTSGTRRAPSPVVSPTEMNKETLPAPLSAATASPSPALSDV
FSLPSQPPSGDLFGLNPAGRSRSPSPSILQQPISNKPFTTKPVHLWTKPDVADWLESLNL
GEHKEAFMDNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR
Download sequence
Identical sequences ENSPTRP00000006892 ENSPTRP00000006892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]