SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000006993 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000006993
Domain Number 1 Region: 5-223
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.31e-50
Family LplA-like 0.0000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000006993   Gene: ENSPTRG00000004066   Transcript: ENSPTRT00000007576
Sequence length 231
Comment pep:known chromosome:CHIMP2.1.4:11:72252945:72254777:-1 gene:ENSPTRG00000004066 transcript:ENSPTRT00000007576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQPAVRLVCLGRVPYAELLGLQDRWLRRLQAEPGIEAPSGTEAGALLLCEPAGPVYTAG
LRGGLTPEETARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVASLE
ACAVRLCELQGLQDARARPPPYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFE
HIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDSPN
Download sequence
Identical sequences H2Q4E2
ENSPTRP00000006993 XP_009422032.1.37143 ENSPTRP00000006993 9598.ENSPTRP00000006993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]