SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007055 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007055
Domain Number 1 Region: 38-582
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.37e-162
Family Motor proteins 0.000000183
Further Details:      
 
Domain Number 2 Region: 1675-1791
Classification Level Classification E-value
Superfamily Second domain of FERM 9.16e-23
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 1040-1143
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.09e-20
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 4 Region: 1792-1882
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-20
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 5 Region: 1135-1229
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000327
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 6 Region: 1394-1464
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000472
Family SH3-domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000007055
Domain Number - Region: 584-652
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000204
Family Motor proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007055   Gene: ENSPTRG00000004098   Transcript: ENSPTRT00000007643
Sequence length 1896
Comment pep:novel chromosome:CHIMP2.1.4:11:74925573:74997245:1 gene:ENSPTRG00000004098 transcript:ENSPTRT00000007643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLQKGDHVWMDLRSGQEFDVPIGAVVKLCDSGQVQVVDDEDNEHWISPQNATHIKPMHP
TSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYILEMSEDQKKKLGLVQASDYYLAMGN
CITCEGRVDSQEYANIRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACE
VLFSPSLATAASLLEVNPPHLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGR
LFVWIVDKINAAIYKPPSQDVKNSRRSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFF
VRHVFKLEQEEYDLESIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTML
HKLNSQHKLNANYIPPKNNHETQFGINHFAGVVYYETQGFLEKNRDTLHGDIIQLVHSSR
NKFIKQIFQADVAMLFDRHLCVRQLRYSGMMETIRIRRAGYPIRYSFVEFVERYRVLLPG
VKPAYKQGDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLEVERDKAITDRVILL
QKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRKNYGLMRLGFLRLQALHRSQKLHQQYR
LARQRIIQFQARCRAYLVRKAFRHRLWAVLTVQAYARGMIARRLHQRLRAEYLRRLEAEK
MRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLAREDAERELKEKEAARRKKELLEQMER
ARHEPVNHSDMVDKMFGFLGTSGGLPGEGQAPSGFEDLERGRREMVEEDLDAALPLPDED
EEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYHDDEGDQLAALAVWITILRFMGDL
PEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGEAQLPEGQKKSSVRHKLV
HLTLKKKSKLTEEVTKRLHDGESTVQGNSMLEDRPTSNLEKLHFIIGNGILRPALRDEIY
CQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLR
RTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSATTAKELCNALADKIS
LKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEVFT
PWHSPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYFVDYGSEMILERLLNL
VPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRRTDAQKVKEDVVNYARFKWPLLFSR
FYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEIMAVSSSRECRVWLSLG
CSDLGCAAPHSGWAGLTPAGPCSPCWSCRGAKTTAPSFTLATIKGDEYTFTSSNAEDIRD
LVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILDHDTGEQVMNSGWANGI
NERTKQRGDFPTDSVYVMPTVTMPPRDIVPPPKHTLSRVMVSKARGKDRLWSHTREPLKQ
ALLKKLLGSEELSQEACLAFIAVLKYMGDYPSKRTRSVNELTDQIFEGPLKAEPLKDEAY
VQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRL
QKALRILPGEEPPVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTYQVFFMKKLWT
TTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKL
LRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQ
TTEPNFPEILLIAINKYGVSLIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSK
LLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRSGK
Download sequence
Identical sequences ENSPTRP00000007055 ENSPTRP00000007055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]