SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007084 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007084
Domain Number 1 Region: 136-472
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.39e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000379
Further Details:      
 
Domain Number 2 Region: 38-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000364
Family Anticodon-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007084   Gene: ENSPTRG00000004117   Transcript: ENSPTRT00000007678
Sequence length 477
Comment pep:known chromosome:CHIMP2.1.4:11:76248968:76387955:-1 gene:ENSPTRG00000004117 transcript:ENSPTRT00000007678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVL
FLHVNDGSSLESLQVVADSGLDSRELTFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIGN
CDAKDFPIKYKERHPLEYLRQHPHFRCRTNVLSSILRIRSEATAAIHSFFKDSGFVHIHT
PIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGP
TFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHK
FIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCG
NIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLA
RSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCVLGVDNIKDVIPFPRFPHSCLL
Download sequence
Identical sequences H2Q4H3
XP_522122.2.37143 9598.ENSPTRP00000007084 ENSPTRP00000007084 ENSPTRP00000007084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]