SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007593 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007593
Domain Number 1 Region: 6-266,297-317
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-79
Family Protein kinases, catalytic subunit 0.000000000152
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000007593
Domain Number - Region: 394-459
Classification Level Classification E-value
Superfamily KA1-like 0.015
Family Ssp2 C-terminal domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007593   Gene: ENSPTRG00000004446   Transcript: ENSPTRT00000008229
Sequence length 476
Comment pep:known chromosome:CHIMP2.1.4:11:123611546:123642722:1 gene:ENSPTRG00000004446 transcript:ENSPTRT00000008229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTVSTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT
Download sequence
Identical sequences A0A2J8WZX8 G1R7A0 G3RMW4 H2Q525
ENSPTRP00000007593 ENSNLEP00000009072 XP_001146296.1.37143 XP_001146365.1.37143 XP_001146525.1.37143 XP_003253401.1.23891 XP_003253402.1.23891 XP_003313450.1.37143 XP_003819961.1.60992 XP_003819962.1.60992 XP_003819963.1.60992 XP_008971577.1.60992 XP_008971578.1.60992 XP_008971579.1.60992 XP_009422718.1.37143 XP_016777728.1.37143 XP_018892072.1.27298 ENSPTRP00000007593 9598.ENSPTRP00000007593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]