SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007598 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000007598
Domain Number - Region: 128-209
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000334
Family Snake venom toxins 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007598   Gene: ENSPTRG00000004447   Transcript: ENSPTRT00000008234
Sequence length 210
Comment pep:known chromosome:CHIMP2.1.4:11:123659506:123668097:-1 gene:ENSPTRG00000004447 transcript:ENSPTRT00000008234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRFFLLMSLYLLGSARGTSGQPDELSGSIDHQTSVQQLPGEPAATEHAEGEHTVGEQPS
GEQPSGEHLSGEQPLSKLESGEQPSDEQPSGEHASGEQPSGEQASGEQPSGEHASGEQAS
GAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGC
ENMCPTMNLFSHGTRMQIICCRNQSFCNKI
Download sequence
Identical sequences A0A2I3T4P0
ENSPTRP00000007598 ENSPTRP00000007598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]