SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007599 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000007599
Domain Number - Region: 47-124
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00117
Family Snake venom toxins 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007599   Gene: ENSPTRG00000004448   Transcript: ENSPTRT00000008235
Sequence length 126
Comment pep:known chromosome:CHIMP2.1.4:11:123730912:123733336:1 gene:ENSPTRG00000004448 transcript:ENSPTRT00000008235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKSLLLELPILLCCFRALSGSLSLRNDAVNEIVAVKNNFPVIEIVQCRMCHLQFPGEKC
SRGRGICTATTEEACMVGRMFKRDGNPWLTFMGCLKNCADVKGIRWSVYLVNFRCCRSHD
LCNEDL
Download sequence
Identical sequences A0A2I3RFB2 G3QMP5
XP_001148003.1.37143 XP_003819952.1.60992 XP_004052434.1.27298 ENSGGOP00000003789 9598.ENSPTRP00000007599 ENSGGOP00000003789 ENSPTRP00000007599 ENSPTRP00000007599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]