SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007673 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007673
Domain Number 1 Region: 244-455
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.47e-49
Family Reprolysin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 552-608
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000118
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 3 Region: 863-915
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000667
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007673   Gene: ENSPTRG00000004483   Transcript: ENSPTRT00000008310
Sequence length 917
Comment pep:novel chromosome:CHIMP2.1.4:11:128439978:128464114:-1 gene:ENSPTRG00000004483 transcript:ENSPTRT00000008310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARARLGGGGAGGAGCASQRGRRGSAPAAGPRGPSRPRIRLIPLFLERAAGPRSGRQHLP
APGGLLPSPARSHRRSPHASRPRRPPVASAPAAAAAAAAGPRRPGPARSWGAGLGAGGAH
AVARLRGCFFSGTVNGEPESLAAVSLCRGLSGSFLLDGEEFTIQPQGAGGSLGQPHRLQR
WGPAGARPLPRGPEWEVETGEGQRQERGDNEEDSEEESQEEEAEGASELPPPLGATSRTK
RFVSEARFVETLLVADASMAAFYGADLQNHILTLMSVAARIYKHPSIKNSVNLMVVKVLI
VEDEKWGPEVSDNGGLTLRNFCNWQRRFNQPSDRHPEHYDTAILLTRQNFCGQEGLCDTL
GVADIGTICDPNKSCSVIEDEGLQAAHTLAHELGHVLSMPHDDSKPCTRLFGPMGKHHVM
APLFVHLNQTLPWSPCSAMYLTELLDGGHGDCLLDAPAAALPLPTGLPGRMALYQLDQQC
RQIFGPDFRHCPNTSAQDVCAQLWCHTDGAEPLCHTKNGSLPWADGTPCRPGHLCSEGSC
LPEEEVERPKLVVDGGWAPWGPWGECSRTCGGGVQFSHRECKGPEPQNGGRYCLGRRAKY
QSCHTEECPPDGKSFREQQCEKYNAYNYTDMDGNLLQWVPKYAGVSPRDRCKLFCRARGR
SEFKVFEAKVIDGTLCGPETLAICVRGQCVKAGCDHVVDSPRKLDKCGVCGGKGNSCRKV
SGSLTPTSYGYNDIVTIPAGATNIDVKQRSHPGVQNDGNYLALKTADGQYLLNGNLAISA
IEQDILVKGTILKYSGSIATLERLQSFRPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDV
DFSMQSSKERATTNIIQPLLHAQWVLGDWSECSSTCGAGWQRRTVECRDPSGQASATCNK
ALKPEDAKPCESQLCPL
Download sequence
Identical sequences ENSPTRP00000007673 ENSPTRP00000007673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]