SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007674 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007674
Domain Number 1 Region: 215-426
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.98e-54
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 514-570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000955
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 890-950
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000772
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 4 Region: 839-891
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000628
Family TSP-1 type 1 repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007674   Gene: ENSPTRG00000004484   Transcript: ENSPTRT00000008311
Sequence length 950
Comment pep:known chromosome:CHIMP2.1.4:11:128484932:128512791:1 gene:ENSPTRG00000004484 transcript:ENSPTRT00000008311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLGILTLAFAGRTAGGSEPEREVVVPIRLDPDINGRRYYWRGPEDSGDQGLIFQITAF
QEDFYLHLMPDAQFLAPAFATEHLGVPLQGLTGGSSDLRRCFYSGDVNAEPDSFAAVSLC
GGLRGAFGYRGAEYVISPLPNASAPAAQRNSQGAHLLQRRGVPGGPSGDPTSRCGVASGW
NPAILRALDPYKPRRAGFGESRSRRRSGRAKRFVSIPRYVETLVVADESMVKFHGADLEH
YLLTLLATAARLYRHPSILNPINIVVVKVLLLRDRDSGPKVTGNAALTLRNFCAWQKKLN
KVSDKHPEYWDTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTA
HELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRANPWSACSAAIITDFLDSGHG
DCLLDQPSKPISLPEDLPGASYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAKGQMVC
QTRHFPWADGTSCGEGKLCLKGACVERHNLNKHRVDGSWAKWDPYGPCSRTCGGGVQLAR
RQCTNPTPANGGKYCEGVRVKYRSCNLEPCPSSASGKSFREEQCEAFNGYNHSTNRLTLA
VAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCSPDSTSVCVQGKCIKAGCD
GNLGSKKRFDKCGVCGGDNKSCKKVTGLFTKPMHGYNFVVAIPAGASSIDIRQRGYKGLI
GDDNYLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRPILEPLT
VEVLSVGKMTPPRVRYSFYLPKEPREDKSSHPKDPRGPSVLHNSVLSLSNQVEQPDDRPP
ARWVAGSWGPCSASCGSGLQKRAVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELS
AWSPCSKSCGRGFKRRPLKCVGHGGRLLARDQCNLQRKPQELDFCVLRPC
Download sequence
Identical sequences H2Q550
9598.ENSPTRP00000007674 XP_522253.2.37143 ENSPTRP00000007674 ENSPTRP00000007674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]