SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008069 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008069
Domain Number 1 Region: 66-98
Classification Level Classification E-value
Superfamily GLA-domain 0.000000000824
Family GLA-domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008069   Gene: ENSPTRG00000004727   Transcript: ENSPTRT00000008732
Sequence length 103
Comment pep:known chromosome:CHIMP2.1.4:12:15165046:15169777:-1 gene:ENSPTRG00000004727 transcript:ENSPTRT00000008732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLILLAILAALAVVTLCYESHESMESYELNPFINRRHANTFISPQQRWRAKVQERIRE
RSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYFRKRRGAK
Download sequence
Identical sequences A0A2I2Z0Z1 H2Q5I7
ENSGGOP00000004397 XP_003816565.1.60992 XP_004052836.1.27298 XP_520764.2.37143 ENSPTRP00000008069 ENSPTRP00000008069 9598.ENSPTRP00000008069 ENSGGOP00000004397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]